Recombinant JCV Polyomavirus Major Capsid VP1 protein (ab74569)
Key features and details
- Expression system: Saccharomyces cerevisiae
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: WB, SDS-PAGE
Description
-
Product name
Recombinant JCV Polyomavirus Major Capsid VP1 protein
See all JCV Polyomavirus Major Capsid VP1 proteins and peptides -
Biological activity
JCV VP1 protein was purified and lyophilized assembled into virus like particles (VLPs). It is tested for hemagglutination activity and analysed using electron microscopy.
-
Purity
> 95 % SDS-PAGE.
Purified by ultracentifugation. -
Expression system
Saccharomyces cerevisiae -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Sequence
MAPTKRKGERKDPVQVPKLLIRGGVEVLEVKTGVDSITEVECFLTPEMGD PDEHLRGFSKSISISDTFESDSPNKDMLPCYSVARIPLPNLNEDLTCGNI LMWEAVTLKTEVLGVTTLMNVHSNGQATHDNGAGKPVQGTSFHFFSVGGE ALELQGVVFNYRTKYPDGTIFPKNATVQSQVMNTEHKAYLDKNKAYPVEC WVPDPTRNENTRYFGTLTGGENVPPVLHITNTATTVLLDEFGVGPLCKGD NLYLSAVDVCGMFTNRSGSQQWRGLSRYFKVQLRKRRVKNPYPISFLLTD LINRRTPKVDGQPMYGMDAQIEEVRVFEGTEELPGDPDMMRYVDRYGQLQ TKML -
Predicted molecular weight
40 kDa -
Actual molecular weight
41 kDa -
Amino acids
1 to 354
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab74569 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
-
Form
Lyophilized -
Additional notes
JCV VP1 protein was purified and lyophilized assembled into virus like particles (VLPs). It is tested for hemagglutination activity and analysed using electron microscopy.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C.
Constituent: PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with deionized H2O. After reconstitution store at 4°C. With the addition of glycerol store at -20°C.
General Info
-
Alternative names
- Capsid protein VP1
-
Relevance
The human polyomavirus JC virus (JCV) infects greater than 80% of the human population. The JC virus is a small (38-40 nm in diameter) double stranded, circular DNA virus covered by an icosahedral capsid. Infection with JCV is asymptomatic and it occurs in early childhood. After the primary infection, the virus remains in latent state in the kidney, until it's reactivation under immunosuppressive conditions to result in Progressive Multifocal Leukoencephalopathy (PML), a fatal demyelinating disease. 70% of all HIV-1- infected patients will exhibit neurological disorders and between 5 and 8% of all HIV-1-infected patients will develop PML. Similar to other polyomaviruses, JCV can cause tumors when intracerebrally inoculated at high titers into developing rodent. Several reports suggest the association of viruses, especially of the polyomavirus family with different types of human brain tumors. Tumorigenecity of JCV is most likely induced by the viral early gene product T-antigen. T-antigen has the capacity to interact with several tumor suppressor proteins, most notably p53, and functionally inactivate these proteins. -
Cellular localization
Virion. Nucleus
Images
-
Recombinant JCV Polyomavirus Major Capsid VP1 protein (ab74569)
Predicted band size: 40 kDaWestern blot showing ab74569 (Lane 1)
MW ladder (Lane 2)
-
SDS-PAGE showing ab74569 (Lane 1)
Lane 2 reprents the molecular weight ladder. -
SDS-PAGE showing ab74569 (4µg/lane).
Lane 1 reprents the molecular weight ladder. From the bottom: 14.4, 18.4, 25.0, 35.0, 45.0, 66.2 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (3)
ab74569 has been referenced in 3 publications.
- López-Moncada F et al. Nucleolar Expression and Chromosomal Associations in Robertsonian Spermatocytes of Mus musculus domesticus. Genes (Basel) 10:N/A (2019). PubMed: 30736350
- Tan CS et al. Brief Report: Decreased JC Virus-Specific Antibody-Dependent Cellular Cytotoxicity in HIV-Seropositive PML Survivors. J Acquir Immune Defic Syndr 82:220-224 (2019). PubMed: 31513076
- Saccardo P et al. Effect of the DnaK chaperone on the conformational quality of JCV VP1 virus-like particles produced in Escherichia coli. Biotechnol Prog 30:744-8 (2014). PubMed: 24574306