Overview

  • Product name
    Recombinant LukD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence
      MKIEKLGKSSVASSIALLLLSNTVDAAQNITPKREKKVDDKITLYKTTAT SDNDKLNIFQILTFNFIKDKSYDKDTLVLKAAGNINSGYKNSNPKDYNYS QFYWGGKYNVSVSSESNDAVNVVDYAPKNQNEEFQVQQTLGYSYGGDINI SNGLSGGLNGSKSFSETINYKQESYRTTIDRKTNHKSIGWGVEAHKIMNN GWGPYGRDSYDPTYGNELFLGGDKSSSNAGQNFLPTHQIPLLARGNFNPE FISVLSHKLFDTKKSKIKVTYQREMDRYTNQWNRSHWVGNNYKNQNTVTF TSTYEVDWQNILLKLIGTDSKETNPGV
    • Molecular weight
      37 kDa
    • Amino acids
      1 to 327
    • Additional sequence information
      From Staphylococcus aureus. Purified.

Specifications

Our Abpromise guarantee covers the use of ab190423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Cytotoxicity can be detected in Human neutrophils when used in combination with LukE in a concentration range of 12.5-800 nM.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Functional Studies

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Leukotoxin LukD

Images

  • SDS-PAGE analysis of ab190423: 1 µg (lane 1) and 5 µg (lane 2).

  • Anti-LukF-PV polyclonal antibody at 0.5 µg/ml + Recombinant LukD protein (ab190423) at 0.1 µg

    Secondary
    Anti-rabbit IgG-HRP conjugate
  • Toxin Functionality: Human promyelocytic leukemia cell line HL60 was differentiated into neutrophils by treatment with DMSO. Neutrophils were incubated with serial dilutions of rLukE and ab190423 alone (Open circles and open squares, respectively) or equimolar concentration of both proteins (Closed circles) for 3 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours. Cells were centrifuged and the OD determined in the supernatants at 470nm. EC50 was found to be 95.1 nM of each toxin subunit.

References

ab190423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up