Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ07813
    • SpeciesMouse
    • SequenceMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDS PREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIM GWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQ
    • Amino acids38 to 171

Specifications

Our Abpromise guarantee covers the use of ab59854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    purified by chromatographic techniques. Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by reducing and non-reducing SDS-PAGE Silver Stained gel.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.16% Tris HCl, 0.03% EDTA, 1.46% Sodium chloride

General Info

  • Alternative names
    • Apoptosis regulator BAX
    • BAX
    • Bax-protein
    • BAX_HUMAN
    • BAXA
    • Baxdelta2G9
    • Baxdelta2G9omega
    • Baxdelta2omega
    • Bcl-2-like protein 4
    • BCL2 associated X protein
    • BCL2 associated X protein omega
    • BCL2 associated X protein transcript variant delta2
    • Bcl2-L-4
    • BCL2L4
    • membrane isoform alpha
    see all
  • FunctionAccelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
  • Tissue specificityExpressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
  • Sequence similaritiesBelongs to the Bcl-2 family.
  • DomainIntact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localizationCytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
  • Information by UniProt

References for Recombinant Mouse Bax protein (ab59854)

ab59854 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab59854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"