Recombinant Mouse C5 / C5a protein (ab90896)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesMouse
    • SequenceMRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPK KCCYDGA RVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPH KPVQLGR
    • Amino acids679 to 755

Specifications

Our Abpromise guarantee covers the use of ab90896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: PBS

  • ReconstitutionReconstitute the vial by injection of 0.5 ml distilled or de-ionised water. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles causes loss of activity.
    For dilutions use protein stabilized phosphate buffered saline, pH 7.4.

General Info

  • Alternative names
    • Anaphylatoxin C5a analog
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
    • C5
    • C5a
    • CO5_HUMAN
    • Complement C5
    • Complement C5 alpha'' chain
    • Complement component C5
    • CPAMD4
    see all
  • FunctionActivation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.
    Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C5a also stimulates the locomotion of polymorphonuclear leukocytes (chemokinesis) and direct their migration toward sites of inflammation (chemotaxis).
  • Involvement in diseaseComplement component 5 deficiency
    An association study of C5 haplotypes and genotypes in individuals with chronic hepatitis C virus infection shows that individuals homozygous for the C5_1 haplotype have a significantly higher stage of liver fibrosis than individuals carrying at least 1 other allele (PubMed:15995705).
  • Sequence similaritiesContains 1 anaphylatoxin-like domain.
    Contains 1 NTR domain.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Mouse C5 / C5a protein (ab90896)

ab90896 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"