Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQV SEGCVAQAANAVREVHVLFLDFP GMLSHLELTLQASKQNGTETQEVFL VLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRK QILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATL EWQPRAQTPVQSCRLEGVSGHK EAYILRILPGSEAGPRTVTVMMELSC TSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELP DTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVV TTPPKDTCSPVLLMSLIQPKCGNQ VMTLALNKKHVQTLQCTITGLTFW DSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRK KVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTV QLDSCHLDLGPEGDMVELIQSRT AKGSCVTLLSPSPEGDPRFSFLLRV YMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
    • Molecular weight
      61 kDa
    • Amino acids
      28 to 578
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab123754 is purified by proprietary chromatographic techniques. Purity is greater than 95% as determined by HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Centrifuge the vial prior to opening.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers. Reconstituted ab123754 should be stored at 4°C for 2-7 days and at -20°C for future use. For long term storage it is recommended to add a carrier protein (0.1 % HSA or BSA). Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • AI528660
    • AI662476
    • CD 105
    • CD105
    • CD105 antigen
    • EGLN_HUMAN
    • END
    • Endoglin
    • Eng
    • FLJ41744
    • HHT1
    • ORW
    • ORW1
    • Osler Rendu Weber syndrome 1
    • RP11 228B15.2
    • S-endoglin
    • SN6
    see all
  • Function
    Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors.
  • Tissue specificity
    Endoglin is restricted to endothelial cells in all tissues except bone marrow.
  • Involvement in disease
    Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1) [MIM:187300, 108010]; also known as Osler-Rendu-Weber syndrome 1 (ORW1). HHT1 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia. Although the first symptom of HHT1 in children is generally nose bleed, there is an important clinical heterogeneity.
  • Cellular localization
    Membrane.
  • Information by UniProt

References for Recombinant Mouse CD105 protein (ab123754)

ab123754 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up