Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      SSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGL YIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDK VYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
    • Molecular weight
      28 kDa including tags
    • Amino acids
      52 to 198
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab168092 binds to Human and mouse CD134 (OX40). It activates T cell proliferation.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water for a final concentration of 0.1mg/ml. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • CD 134L
    • CD 252
    • CD134
    • CD134 ligand
    • CD134L
    • CD252
    • CD252 antigen
    • glycoprotein 34 kd
    • Glycoprotein Gp34
    • GP34
    • OX-40L
    • OX40 antigen ligand
    • OX40 ligand
    • OX40L
    • TAX transcriptionally-activated glycoprotein 1
    • TNFL4_HUMAN
    • Tnfsf4
    • Tumor necrosis factor (ligand) superfamily member 4
    • Tumor necrosis factor ligand superfamily member 4
    • TXGP1
    see all
  • Function
    Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
  • Involvement in disease
    Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab168092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up