Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYW IGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERD SGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYG PQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAE TQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFN CSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNVDHHHH HH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      39 to 332
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab194057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names
    • A.11
    • AI528707
    • CD62 antigen ligand
    • CD62 antigen-like family member L
    • CD62L
    • gp90-MEL
    • IgA nephropathy, susceptibility to, included
    • L Selectin
    • L-selectin
    • LAM-1
    • LAM1
    • LECAM1
    • LEU8
    • Leukocyte adhesion molecule 1
    • Leukocyte surface antigen Leu-8
    • Leukocyte-endothelial cell adhesion molecule 1
    • Lnhr
    • LSEL
    • Ly-22
    • Ly-m22
    • Lyam-1
    • LYAM1
    • LYAM1_HUMAN
    • Lymph node homing receptor
    • Lymphocyte adhesion molecule 1
    • Lymphocyte antigen 22
    • Lymphocyte surface MEL-14 antigen
    • MEL-14
    • Pln homing receptor
    • PLNHR
    • Selectin L
    • Selectin, lymphocyte
    • SELL
    • TQ1
    see all
  • Function
    Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
  • Tissue specificity
    Expressed in B cell lines and T lymphocytes.
  • Sequence similarities
    Belongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab194057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up