Recombinant Mouse CD90 / Thy1 protein (ab157082)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLG IPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNK SISVYRDKLVKC
    • Molecular weight
      48 kDa
    • Amino acids
      20 to 131
    • Additional sequence information
      The extracellular domain of mouse Thy1 (aa 20-131) is fused to the Fc portion of human IgG1

Specifications

Our Abpromise guarantee covers the use of ab157082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 50µl sterile distilled water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein.

General Info

  • Alternative names
    • CD7
    • CD90
    • CD90 antigen
    • CDw90
    • FLJ33325
    • MGC128895
    • T25
    • Theta antigen
    • Thy 1
    • Thy 1 cell surface antigen
    • Thy 1 membrane glycoprotein
    • Thy 1 T cell antigen
    • Thy 1.2
    • Thy-1 antigen
    • Thy-1 membrane glycoprotein
    • Thy1
    • Thy1 antigen
    • Thy1 T cell antigen
    • Thy1.1
    • Thy1.2
    • THY1_HUMAN
    • Thymus cell antigen 1, theta
    see all
  • Function
    May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab157082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up