Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionQ8JZM4
    • SpeciesMouse
    • SequenceMPPRRAQAPGAPLLPVLALLPLLLGAGPQSGCLASPVSAAPLPAPGPCAS QPCRNGGVCTPRSVTDQEHPAADAEPRYSCTCPAGVSGTYCQFVADPCAS NPCHHGNCSSSSSSSSDSYLCICNDGYEGLNCEQPLPSIPTSGWTESTAP RQLQPVPATQEPDIILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVVPDV ACGNASSNNSAGGRLVSFEVPQNTSVKIRQDANSLLILLWKVTATGFQQC SLIDGRSVTPLQAPGGLVLLEEMLALGPNHFIGFVNDSVAKSIVALRLTL VVKASNCVPGDSHSNDLECSGKGKCATKPSEATFSCTCQDQYIGTFCEEF DACQRKPCQNEASCIDANEKQDGSNFTCLCLPGYTGELCQSKIDYCVLDP CRNGATCVSSLSGFTCQCLEGYFGSACEEKVDPCMSSPCQNNGTCYVDGV HFTCSCSPGFTGPTCAQLVDFCALSPCAHGMCRSVGTSYKCLCDPGYHGL YCEEEYNECLSAPCLNAATCRDLINGYECVCLAEYKGTHCELYKDPCANI SCLNGGTCDSEGLNGTCICAPGFTGEECDIDINECDSNPCHHAGTCLDQP NGYTCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLY
    • Molecular weight68 kDa
    • Amino acids1 to 640

Specifications

Our Abpromise guarantee covers the use of ab109358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level< 0.100 Eu/µg
  • Purity>= 85 % SDS-PAGE.
    ab109358 is 0.2 µm filtered.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: PBS

General Info

  • Alternative names
    • bet
    • Brain EGF repeat-containing transmembrane protein
    • Bret
    • Delta and Notch-like epidermal growth factor-related receptor
    • Delta notch like EGF repeat containing transmembrane
    • Delta/notch like EGF repeat containing
    • Delta/notch-like EGF-related receptor
    • Dner
    • DNER_HUMAN
    • PRO299
    • Transmembrane protein Bet
    • UNQ26
    see all
  • FunctionActivator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.
  • Tissue specificityExpressed in brain, spinal cord and adrenal gland.
  • Sequence similaritiesContains 10 EGF-like domains.
    Contains 1 follistatin-like domain.
  • Cellular localizationCell membrane. Present on the membrane of dendrites and cell bodies but excluded from axonal membrane. Also found in early endosomes in the somatodendritic region (By similarity).
  • Information by UniProt

References for Recombinant Mouse DNER protein (ab109358)

ab109358 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"