Recombinant mouse EPO protein (Fc Chimera) (ab170076)

Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYA WKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAIS GLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLR GKLKLYTGEVCRRGDR
    • Molecular weight
      49 kDa
    • Amino acids
      27 to 192

Specifications

Our Abpromise guarantee covers the use of ab170076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ED50 < 5 ng/ml as determined in a cell proliferation assay using Human TF-1 erythroleukemia cells.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .
    ab170076 is purified by chromatography, sterile filtered and lyophilized.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 100% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add 0.5ml deionized water. Aliquot and freeze unused portion.

General Info

  • Alternative names
    • EP
    • EPO
    • EPO alpha
    • Epoetin
    • Erythropoetin
    • Erythropoietin precursor
    • MVCD2
    see all
  • Relevance
    Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Cellular localization
    Secreted

Images

  • SDS-PAGE analysis of ab170076.

    Lane 1: 3µg ab170076 Reduced
    Lane 2: 3µg ab170076 Non-reduced
    Lane 3: Molecular weight markers

  • Proliferation of Human TF-1 erythroleukemia cells by ab170076.

References

ab170076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up