Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPTKAA
    • Molecular weight
      22 kDa
    • Amino acids
      49 to 118

Specifications

Our Abpromise guarantee covers the use of ab9861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The ED50 was determined by a cell proliferation assay using FDC-P1 cells is < 2.0 ng/ml, corresponding to a specific activity of > 5 x 105 units/mg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • IBP1
    • IGF I
    • IGF IA
    • IGF IB
    • IGF-I
    • Igf1
    • IGF1_HUMAN
    • IGF1A
    • IGFI
    • IGFIA
    • Insulin like growth factor 1
    • Insulin like growth factor 1 (somatomedin C)
    • Insulin like growth factor IA
    • Insulin like growth factor IB
    • Insulin-like growth factor I
    • Mechano growth factor
    • MGF
    • OTTHUMP00000195080
    • OTTHUMP00000195081
    • OTTHUMP00000195082
    • OTTHUMP00000195083
    • OTTHUMP00000195084
    • Somatomedia C
    • Somatomedin C
    • Somatomedin-C
    see all
  • Function
    The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.
  • Involvement in disease
    Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation.
  • Sequence similarities
    Belongs to the insulin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

This product has been referenced in:

See all 5 Publications for this product

Customer reviews and Q&As

Thank you for your enquiry. This product is shipped as a lyophilised powder with no additives. There is no BSA added. The price of the antibody depends on the country you are ordering from. From your account information I see that you are located in Be...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up