Recombinant Mouse IgG1 protein (Fc Chimera) (ab180055)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVE VHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIE KTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQW NGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLH NHHTEKSLSHSPGK
    • Molecular weight
      24 kDa
    • Amino acids
      111 to 324
    • Additional sequence information
      The fragment corresponds to the CH2 and CH3 domains. Genbank entry: AAK53870.1.

Specifications

Our Abpromise guarantee covers the use of ab180055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

General Info

  • Alternative names
    • Ig gamma 1 chain C region
    • IgG heavy chain locus
    • IGHG1
    • Immunoglobulin Gm1
    • Immunoglobulin heavy constant gamma 1 (G1m marker)
    see all
  • Relevance
    There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant).
  • Cellular localization
    Secreted. Cell membrane; Single-pass membrane protein

Images

  • SDS-PAGE analysis of ab180055 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 28-30 kDa due to glycosylation.

References

ab180055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up