Recombinant mouse IL-17AF protein (ab109674)

Overview

  • Product name
    Recombinant mouse IL-17AF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Mouse
    • Sequence
      IL-17A subunit: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRST SPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
      IL-17F subunit: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSS SPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILV LRREP
    • Molecular weight
      31 kDa
    • Additional sequence information
      ab109674 is a disulfide-linked heterodimer. It contains one IL-17A subunit and one IL-17F subunit. It contains 271 amino acids and has a molecular weight of 30.7 kDa.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab109674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75-325 ng/mL.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes

    Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It contains one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    Preservative: None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute ab109674 with sterile water to a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.

General Info

  • Relevance
    Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells.

Images

  • ab109674 used in Western Blot. Figure: 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.

References

ab109674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up