Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8VHH8
    • SpeciesMouse
    • SequenceVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESC RASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM DPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPR VMA
    • Molecular weight35 kDa
    • Amino acids17 to 169
    • Additional sequence informationRecombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa.

Specifications

Our Abpromise guarantee covers the use of ab117679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity> 95 % SDS-PAGE.
    ab117679 was purified by proprietary chromatographic techniques and filter sterilized. Purity was determined to be greater than 95.0% as determined by RP-HPLC and by SDS-PAGE.
  • FormLyophilised
  • Additional notesLyophilized ab117679 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution, ab117679 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    Constituent: 99% Water

  • Reconstitutionab117679 was lyophilized from a concentrated (1 mg/ml) solution. It is recommended to reconstitute the lyophilized antibody in sterile ultra pure water, not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • IL 17E
    • IL 25
    • IL-17E
    • IL-25
    • IL17e
    • IL25
    • IL25_HUMAN
    • Interleukin 17E
    • Interleukin 25
    • Interleukin-17E
    • Interleukin-25
    • Interleukin17E
    • Interleukin25
    • OTTHUMP00000027946
    • OTTHUMP00000246238
    • UNQ3120/PRO10272
    see all
  • FunctionInduces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
  • Tissue specificityExpressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
  • Sequence similaritiesBelongs to the IL-17 family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Mouse IL17E protein (ab117679)

ab117679 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"