Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESC RASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM DPLGNSVPLYHNQTVFYRRPCHGEEGTRRYCLERRLYRVSLACVCVRPRV MA
    • Molecular weight
      35 kDa
    • Amino acids
      17 to 169

Specifications

Our Abpromise guarantee covers the use of ab119730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.
    Purity by SDS-PAGE and HPLC: = or > 95% Endotoxin level is < 0.01 ng per µg of ab119730.
  • Form
    Lyophilised
  • Additional notes
    The lyophilized ab119730 is best-stored desiccated at -20 °C. Upon reconstitution the product should be aliquoted and stored at -20 °C. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

  • Reconstitution
    Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile 5 mM Acetic acid to a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions.

General Info

  • Alternative names
    • IL 17E
    • IL 25
    • IL-17E
    • IL-25
    • IL17e
    • IL25
    • IL25_HUMAN
    • Interleukin 17E
    • Interleukin 25
    • Interleukin-17E
    • Interleukin-25
    • Interleukin17E
    • Interleukin25
    • OTTHUMP00000027946
    • OTTHUMP00000246238
    • UNQ3120/PRO10272
    see all
  • Function
    Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
  • Tissue specificity
    Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant Mouse IL17E protein (ab119730)

ab119730 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up