Recombinant mouse IL2 protein (Fc Chimera) (ab183262)

Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ
    • Molecular weight
      43 kDa
    • Amino acids
      21 to 169
    • Additional sequence information
      Mouse IL2 is glycosylated and expressed as a chimera with the Fc region of mouse immunoglobulin (heavy chain hinge, CH2 and CH3).

Specifications

Our Abpromise guarantee covers the use of ab183262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ED50 < 5 ng/ml as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells (Gearing and Bird (1987) Production and assay of IL2. In Lymphokines and Interferons: A Practical Approach (Clemens et al. eds.) pp. 291-301). The ED50 for this effect is typically < 1.0 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    = 98 % SDS-PAGE.
    ab183262 is purified by chromatography, then sterile filtered.
  • Form
    Lyophilised
  • Additional notes

    Extinction coefficient: 0.9

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C.

    Constituents: 99% PBS, 0.1% BSA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Add 0.025 ml distilled water.

General Info

  • Alternative names
    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function
    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease
    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities
    Belongs to the IL-2 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab183262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up