Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ6EAL8
    • SpeciesMouse
    • SequenceMTCSLSFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQL PCFSLDREALTNISVIIAHLEKVKVLSENTVDTSWVIRWLTNISCFNPLN LNISVPGNTDESYDCKVFVLTVLKQFSNCMAELQAKDNTTC
    • Molecular weight16 kDa
    • Amino acids24 to 163

Specifications

Our Abpromise guarantee covers the use of ab119155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe activity is determined by the dose dependent production of IL-8 from human PBMCs and is typically less than 25 ng/mL.
  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    Protein content and purity of ab119155 was determined by UV spectroscopy at 280 nm, RP-HPLC calibrated against a known standard and quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.
  • FormLyophilised
  • Additional notesIt is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituent: 0.14% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionLyophilized product is very stable at -20°C. Centrifuge vial before opening. When reconstituting, gently pipette and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute ab119155 with sterile water at a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions.

General Info

  • Alternative names
    • IL 31
    • IL-31
    • IL31
    • IL31_HUMAN
    • Interleukin 31
    • Interleukin-31
    see all
  • FunctionActivates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL31 may function in skin immunity.
  • Tissue specificityDetected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant mouse IL31 protein images

  • ab119155 used in Western Blot. Figure: 1 ug run under (+) reducing conditions and (-) non-reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-31 has a predicted MW of 15.7 kDa.

References for Recombinant mouse IL31 protein (ab119155)

ab119155 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"