Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTK EAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVK EQKKNDACFLKRLLREIKTCWNKILKGSI
    • Molecular weight
      15 kDa
    • Amino acids
      26 to 154
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab181948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 of this protein, as measured by 2E8 cell proliferation assay, is less than or equal to 1.6 ng/ml. This corresponds to a specific activity of greater than or equal to 6.3 x 105 Units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 98 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes

    Endotoxin Level: Less than 0.01 ng/μg cytokine as determined by the LAL assay.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituents: 35% Acetonitrile, 0.1% Trifluoroacetic acid

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function
    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities
    Belongs to the IL-7/IL-9 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab181948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up