Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDT KEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNV KEQKKNDACFLKRLLREIKTCWNKILKGSI
    • Molecular weight
      20 kDa
    • Amino acids
      26 to 154

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The ED50, determined by the dose-dependent stimulation of the proliferation of murine IXN/2B cells, is < 0.2 ng/ml, corresponding to a specific activity of > 5 x 106 units/mg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function
    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities
    Belongs to the IL-7/IL-9 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant mouse IL7 protein (ab9733)

ab9733 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab9733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up