Recombinant Mouse KDM5B / PLU1 / Jarid1B protein (ab198142)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      EPATTLPPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHK IRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKL NFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRK WTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTS DTKDKEYKPHDIPQRQSVQPAETCPPARRAKRMRAEAMNIKIEPEEATEA RTHNLRRRMGCTTPKWENEKEMKSTIKQEPTEKKDCELESEKEKPKSRAK KTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDW RCPKCLAQECNKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMV PTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKISPEE EEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIE DHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQ LVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVN FCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTV QKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCIKCKTTCFM SAISCSCKPGLLVCLHHVKELCSCPPYKYNLRYRYTLDDLYPMMNALKLR
    • Molecular weight
      86 kDa including tags
    • Amino acids
      2 to 751
    • Tags
      DDDDK tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_152895

Specifications

Our Abpromise guarantee covers the use of ab198142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 50 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 10% Glycerol

General Info

  • Alternative names
    • Cancer/testis antigen 31
    • CT31
    • Histone demethylase JARID1B
    • JARID1B
    • Jumonji AT rich interactive domain 1B
    • Jumonji/ARID domain-containing protein 1B
    • Kdm5b
    • KDM5B_HUMAN
    • Lysine (K) specific demethylase 5B
    • Lysine demethylase 5B
    • Lysine specific demethylase 5B
    • Lysine-specific demethylase 5B
    • PLU-1
    • PLU1
    • PPP1R98
    • Protein phosphatase 1 regulatory subunit 98
    • PUT1
    • putative DNA/chromatin binding motif
    • RBBP2H1A
    • RBP2 like
    • RBP2-H1
    • Retinoblastoma-binding protein 2 homolog 1
    • Retinoblastoma-binding protein 2 homolog 1A
    see all
  • Function
    Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in testis. Down-regulated in melanoma and glioblastoma. Up-regulated in breast cancer (at protein level).
  • Sequence similarities
    Belongs to the JARID1 histone demethylase family.
    Contains 1 ARID domain.
    Contains 1 JmjC domain.
    Contains 1 JmjN domain.
    Contains 3 PHD-type zinc fingers.
  • Domain
    Both the JmjC domain and the JmjN domain are required for enzymatic activity.
    The 2 first PHD-type zinc finger domains are required for transcription repression activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 10% SDS-PAGE Coomassie staining. Lane 1: 4 µg ab198142. Lane 2: Protein Marker

References

ab198142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up