Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQG EPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITR DQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
    • Molecular weight
      20 kDa
    • Amino acids
      24 to 203

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity
    > 95 % SDS-PAGE.
    ab123757 is purified by proprietary chromatographic techniques. Purity is greater than 95% as determined by HPLC and SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituents: PBS, 0.02% Tween

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers

General Info

  • Alternative names
    • CDF
    • Cholinergic Differentiation Factor
    • D factor
    • DIA
    • Differentiation inducing factor
    • differentiation inhibitory activity
    • Differentiation stimulating factor
    • Differentiation-stimulating factor
    • Emfilermin
    • Hepatocyte stimulating factor III
    • HILDA
    • Human interleukin in DA cells
    • Leukemia inhibitory factor
    • LIF
    • LIF_HUMAN
    • Melanoma derived LPL inhibitor
    • Melanoma-derived LPL inhibitor
    • MLPLI
    see all
  • Function
    LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
  • Sequence similarities
    Belongs to the LIF/OSM family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab123757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up