Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09056
    • SpeciesMouse
    • SequenceMSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQG EPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITR DQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
    • Molecular weight20 kDa
    • Amino acids24 to 203

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity> 95 % SDS-PAGE.
    ab123757 is purified by proprietary chromatographic techniques. Purity is greater than 95% as determined by HPLC and SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituents: PBS, 0.02% Tween

  • ReconstitutionCentrifuge the vial prior to opening. Reconstitute in sterile H2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers

General Info

  • Alternative names
    • CDF
    • Cholinergic Differentiation Factor
    • D factor
    • DIA
    • Differentiation inducing factor
    • differentiation inhibitory activity
    • Differentiation stimulating factor
    • Differentiation-stimulating factor
    • Emfilermin
    • Hepatocyte stimulating factor III
    • HILDA
    • Human interleukin in DA cells
    • Leukemia inhibitory factor
    • LIF
    • LIF_HUMAN
    • Melanoma derived LPL inhibitor
    • Melanoma-derived LPL inhibitor
    • MLPLI
    see all
  • FunctionLIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
  • Sequence similaritiesBelongs to the LIF/OSM family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Mouse LIF protein (ab123757)

ab123757 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"