Recombinant Mouse Lysophospholipase 1 protein (ab101156)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP97823
    • SpeciesMouse
    • SequenceMGSSHHHHHHSSGLVPRGSHMCGNNMSAPMPAVVPAARKATAAVIFLHGL GDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSP DSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTAL TTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM FGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
    • Molecular weight27 kDa including tags
    • Amino acids1 to 230
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101156 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Acyl protein thioesterase 1
    • Acyl-protein thioesterase 1
    • APT 1
    • APT-1
    • APT1
    • hAPT1
    • LPL-I
    • LPL1
    • LYPA1_HUMAN
    • LYPLA 1
    • LYPLA1
    • Lysophospholipase 1
    • Lysophospholipase I
    • Lysophospholipid specific lysophospholipase
    • LYSOPLA
    • LysoPLA I
    see all
  • FunctionHydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.
  • Sequence similaritiesBelongs to the AB hydrolase 2 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Mouse Lysophospholipase 1 protein images

  • 15% SDS-PAGE showing ab101156 at approximately 26.8 kDa (3 µg).

References for Recombinant Mouse Lysophospholipase 1 protein (ab101156)

ab101156 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry.

I am sorry to confirm that we have not tested if this protein is re-folded correctly after purification and therefore do not know if it is active.

I am sorry that I do not have a positive answer or you on...

Read More

Thank you very much for your interest in the Lysophospholipase 1 protein (ab101156).

We do not have tested this protein in regards to its activity and can therefore not make any prediction. I would like to point out, that the protein is in a ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"