Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTPTPKP
    • Molecular weight
      11 kDa
    • Amino acids
      24 to 97

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product was determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • C-C motif chemokine 7
    • Ccl7
    • CCL7_HUMAN
    • Chemokine CC motif ligand 7
    • FIC
    • MARC
    • MCP-3
    • Monocyte chemoattractant protein 3
    • Monocyte chemotactic protein 3
    • NC28
    • RP23-350G1.4
    • SCYA6
    • SCYA7
    • Small-inducible cytokine A7
    see all
  • Function
    Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant mouse MCP3 protein (ab9912)

ab9912 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab9912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up