Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTPTPKP
    • Molecular weight
      11 kDa
    • Amino acids
      24 to 97

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product was determined by its ability to chemoattract Balb/c mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • C-C motif chemokine 7
    • Ccl7
    • CCL7_HUMAN
    • Chemokine CC motif ligand 7
    • FIC
    • MARC
    • MCP-3
    • Monocyte chemoattractant protein 3
    • Monocyte chemotactic protein 3
    • NC28
    • RP23-350G1.4
    • SCYA6
    • SCYA7
    • Small-inducible cytokine A7
    see all
  • Function
    Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab9912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up