Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP27005
    • SpeciesMouse
    • SequenceMGSSHHHHHHSSGLVPRGSHMPSELEKALSNLIDVYHNYSNIQGNHHALY KNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGV ASHKDSHKE
    • Molecular weight12 kDa including tags
    • Amino acids1 to 89
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab108120 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 60B8Ag
    • AI323541
    • B8Ag
    • BEE11
    • CAGA
    • Calgranulin-A
    • Calprotectin L1L subunit
    • Calprotectin, included
    • CFAG
    • CGLA
    • Chemotactic cytokine CP-10
    • CP-10
    • Cystic fibrosis antigen
    • L1Ag
    • Leukocyte L1 complex light chain
    • MA387
    • MIF
    • Migration inhibitory factor-related protein 8
    • MRP-8
    • Myeloid-related protein 8
    • Neutrophil cytosolic 7 kDa protein
    • NIF
    • p8
    • Pro-inflammatory S100 cytokine
    • Protein S100-A8
    • S100 calcium binding protein A8
    • S100 calcium binding protein A8 (calgranulin A)
    • S100 calcium-binding protein A8
    • S100A8
    • S100A8/S100A9 complex, included
    • S10A8_HUMAN
    • Urinary stone protein band A
    see all
  • FunctionCalcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificityExpressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localizationSecreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
  • Information by UniProt

Recombinant Mouse MRP8 protein images

  • 15% SDS-PAGE showing ab108120 at approximately 12.4kDa (3µg).

References for Recombinant Mouse MRP8 protein (ab108120)

ab108120 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"