Recombinant mouse PAI1 protein (ab93068)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP22777
    • SpeciesMouse
    • SequenceLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDWVERHTKGMIND LLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVP MMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSAL TNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS ATLADFTSLSDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPT EMVIDRSFLFVVRHNPTETILFMGQVMEP
    • Amino acids24 to 402

Specifications

Our Abpromise guarantee covers the use of ab93068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab93068 is 80 (+/-) 5% active by uPA titration. The active fraction typically contains 70 percent active PAI1. Active concentration = ~2.0 mg/mL.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.1M Sodium chloride, 0.05M Sodium acetate, 1mM EDTA, pH 5.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Clade E
    • Endothelial plasminogen activator inhibitor
    • Nexin
    • PAI
    • PAI 1
    • PAI-1
    • PAI1_HUMAN
    • PLANH1
    • Plasminogen activator inhibitor 1
    • Plasminogen activator inhibitor type 1
    • Serine (or cysteine) proteinase inhibitor
    • Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpin E1
    • Serpin peptidase inhibitor clade E
    • Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpine 1
    • SERPINE1
    see all
  • FunctionThis inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
  • Tissue specificityFound in plasma and platelets and in endothelial, hepatoma and fibrosarcoma cells.
  • Involvement in diseaseDefects in SERPINE1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1D) [MIM:613329]. It is a hematologic disorder characterized by increased bleeding after trauma, injury, or surgery. Affected females have menorrhagia. The bleeding defect is due to increased fibrinolysis of fibrin blood clots due to deficiency of plasminogen activator inhibitor-1, which inhibits tissue and urinary activators of plasminogen.
    Note=High concentrations of SERPINE1 seem to contribute to the development of venous but not arterial occlusions.
  • Sequence similaritiesBelongs to the serpin family.
  • Post-translational
    modifications
    Inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (TPA), cleaving the 369-Arg-
    -Met-370 bond.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant mouse PAI1 protein images

  • 10% SDS-PAGE
    Lane 1: PAI1 (5 µg) Reduced
    Lane 2: PAI1 (5 µg) +uPA-HTC (8 µg) Reduced
    Lane 3: Prestained Standard

References for Recombinant mouse PAI1 protein (ab93068)

ab93068 has not yet been referenced specifically in any publications.

Product Wall

It is hard to give an exact answer since there are countless possible experiments where PAI-1 is injected into mice. All of the papers below inject PAI into either rats or mice. Some of the experiments were acute 1 time injections and some were long-t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"