Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf21 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGG KDADRTKDNRDSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLN QTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKTGQHSLVTCSGDLN KAKEIFQKKFLDKTKNNWEDRENFEKVPGKYDMLQMDYAASTQDESKTKE EETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKRAPLGKLTVAQ IKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDH ESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRM LLWHGSRLSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYC FASRLKNTGLLLLSEVALGQCNELLEANPKAQGLLRGKHSTKGMGKMAPS PAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSPNQVRMRYLLK IQFNFLQLW
    • Molecular weight
      63 kDa
    • Amino acids
      1 to 559

Specifications

Our Abpromise guarantee covers the use of ab168074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Preservative: 0.34% Imidazole
    Constituents: 0.2% Tergitol-NP40, 0.79% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ADP ribosyltransferase like 2
    • ADP-ribosyltransferase diphtheria toxin-like 2
    • ADPRT 2
    • ADPRT-2
    • ADPRT2
    • ADPRTL 2
    • ADPRTL 3
    • ADPRTL2
    • ADPRTL3
    • ARTD2
    • hPARP 2
    • hPARP-2
    • hPARP2
    • NAD(+) ADP ribosyltransferase 2
    • NAD(+) ADP-ribosyltransferase 2
    • pADPRT 2
    • pADPRT-2
    • pADPRT2
    • PARP 2
    • PARP-2
    • PARP2
    • PARP2_HUMAN
    • Poly (ADP ribose) polymerase family member 2
    • Poly (ADP ribosyl) transferase like 2
    • poly (ADP-ribose) polymerase 2
    • Poly [ADP ribose] synthetase 2
    • Poly [ADP-ribose] polymerase 2
    • Poly(ADP ribose) synthetase
    • Poly[ADP-ribose] synthase 2
    see all
  • Function
    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.
  • Tissue specificity
    Widely expressed, mainly in actively dividing tissues. The highest levels are in the brain, heart, pancreas, skeletal muscle and testis; also detected in kidney, liver, lung, placenta, ovary and spleen; levels are low in leukocytes, colon, small intestine, prostate and thymus.
  • Sequence similarities
    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
  • Post-translational
    modifications
    Poly-ADP-ribosylated by PARP1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab168074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up