Recombinant Mouse PLGF protein (His tag) (ab194182)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: HPLC, SDS-PAGE
Description
-
Product name
Recombinant Mouse PLGF protein (His tag)
See all PLGF proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHI FSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMT FSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPVDHHHHHH -
Predicted molecular weight
17 kDa including tags -
Amino acids
19 to 158 -
Tags
His tag C-Terminus -
Additional sequence information
This product is the mature full length protein from aa 19 to 158. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab194182 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Reconstitute for long term storage.
pH: 7.40
Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- D12S1900
- Pgf
- PGFL
see all -
Function
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. -
Tissue specificity
While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Domain
Isoform PlGF-2 contains a basic insert which acts as a cell retention signal. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab194182 has not yet been referenced specifically in any publications.