Recombinant Mouse PLGF protein (His tag) (ab194182)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHI FSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMT FSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPVDHHHHHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      19 to 158
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 19 to 158. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • D12S1900
    • Pgf
    • PGFL
    • PIGF
    • Placenta growth factor
    • Placental growth factor
    • Placental growth factor, vascular endothelial growth factor related protein
    • PlGF
    • PlGF 2
    • PLGF_HUMAN
    • PlGF2
    • SHGC 10760
    see all
  • Function
    Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner.
  • Tissue specificity
    While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Domain
    Isoform PlGF-2 contains a basic insert which acts as a cell retention signal.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
  • Information by UniProt

References

ab194182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up