Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ3UZA1
    • SpeciesMouse
    • SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEERPSETNSNVDSSAQPSV AQLAGRFREHAAVARETPASKPTRRKPPCSLPLFPPKVELGQNGEEKSPS GASHPPKIKVKSSPLIEKLQANLAFDPAALLPGASPKSPGLKAIVSPFHS PPSTPSSPGIRSHPSEAEEVPVSFDQPPEGTHLPSYNKVRTRGSIKRRPP SRRFRRSQSDCGDFRDYRAVEPSQENGAREENGDDVFASKSKDPGSPQLN QEAMADGVEGTPWSAEKPRRRNTCNSTEKPEELVRTPEEANAGEKVGQNP DTASQGHPEVQAPSQTGSPEAENGCGSPREETTPGEHTDTGKATEGTASE ERVADEDRLGQKSPDANMPEEEGVVREKAPQTSSGKAEGTTIAEPDTKQK EEAPLEPSCSPGADHAAGEITSEIQNEKAVSMDDIPIEDTRM
    • Molecular weight71 kDa including tags
    • Amino acids2 to 412

Specifications

Our Abpromise guarantee covers the use of ab116533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 80 % Proprietary Purification.

  • FormLiquid
  • Additional notesTheoretical pI: 5.25
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • A430105K13Rik
    • BC025872
    • CapZ interacting protein
    • Capz-interacting protein
    • CAPZIP
    • CPZIP_HUMAN
    • MGC126585
    • MGC126611
    • MGC128398
    • MGC21854
    • MGC32399
    • MK2S4
    • Protein kinase substrate CapZIP
    • Protein kinase substrate MK2S4
    • RCSD domain containing 1
    • RCSD domain-containing protein 1
    • Rcsd1
    • RGD1304715
    • RP3-503M14.1
    see all
  • FunctionStress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.
  • Tissue specificityHighly expressed in skeletal muscle and more weakly in cardiac muscle. Also expressed in several lymphoid organs, including spleen, thymus, peripheral blood leukocytes, lymph node and bone marrow.
  • Sequence similaritiesContains 1 RCSD domain.
  • Post-translational
    modifications
    Dephosphorylation results in its dissociation from CAPZA2.
  • Information by UniProt

Recombinant mouse RCSD 1 protein images

  • 12% SDS-PAGE gel showing ab116533.

References for Recombinant mouse RCSD 1 protein (ab116533)

ab116533 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"