Recombinant Mouse S100 alpha 6 protein (ab108124)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLS KKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGAL ALIYNEALK
    • Molecular weight
      12 kDa including tags
    • Amino acids
      1 to 89
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2A9
    • 5B10
    • CABP
    • CACY
    • Calcyclin
    • Growth factor inducible protein 2A9
    • Growth factor-inducible protein 2A9
    • MLN 4
    • MLN4
    • OTTHUMP00000015472
    • OTTHUMP00000015473
    • PRA
    • PRAGrowth factor inducible protein 2A9
    • Prolactin receptor associated protein
    • Prolactin receptor-associated protein
    • Protein S100 A6
    • Protein S100-A6
    • S100 A6
    • S100 calcium binding protein A6
    • S100 calcium binding protein A6 (calcyclin)
    • S100 calcium-binding protein A6
    • S100A6
    • S10A6_HUMAN
    see all
  • Function
    May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
  • Sequence similarities
    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Nucleus envelope. Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab108124 (3µg).

References

ab108124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up