Recombinant Mouse S100 alpha protein (ab108117)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP56565
    • SpeciesMouse
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLS KKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVA ALTVACNNFFWETS
    • Molecular weight13 kDa including tags
    • Amino acids1 to 94
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab108117 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Protein S100-A1
    • S-100 protein alpha chain
    • S-100 protein subunit alpha
    • S100
    • S100 Calcium Binding Protein A1
    • S100 calcium-binding protein A1
    • S100 protein alpha polypeptide
    • S100A
    • s100a1
    • S10A1_HUMAN
    see all
  • FunctionWeakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites.
  • Tissue specificityHighly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Mouse S100 alpha protein images

  • 15% SDS-PAGE showing ab108117 at approximately 12.6kDa (3µg).

References for Recombinant Mouse S100 alpha protein (ab108117)

ab108117 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"