Recombinant Mouse S100A4 protein (ab109341)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07091
    • SpeciesMouse
    • SequenceMGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLN KTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLS CIAMMCNEFFEGCPDKEPRKK
    • Molecular weight14 kDa including tags
    • Amino acids1 to 101
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109341 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 18A2
    • 42A
    • calcium Placental protein
    • Calvasculin
    • CAPL
    • Fibroblast specific protein
    • Fibroblast specific protein 1
    • FSP1
    • Leukemia multidrug resistance associated protein
    • Malignant transformation suppression 1
    • Metastasin
    • MTS1
    • OTTHUMP00000015467
    • OTTHUMP00000015468
    • P9KA
    • PEL98
    • Placental calcium-binding protein
    • Protein Mts1
    • Protein S100 A4
    • Protein S100-A4
    • S100 calcium binding protein A4
    • S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
    • S100 calcium-binding protein A4
    • S100a4
    • S10A4_HUMAN
    see all
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Mouse S100A4 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109341.

References for Recombinant Mouse S100A4 protein (ab109341)

ab109341 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"