Recombinant mouse TWEAKR/FN14 protein (ab157284)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse TWEAKR/FN14 protein
See all TWEAKR/FN14 proteins and peptides -
Biological activity
Binds Human and mouse TWEAK.
Inhibits TWEAK-mediated killing of Kym-1 target cells. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM DCASCPARPHSDFCLGCAAAPPAHF -
Predicted molecular weight
34 kDa -
Amino acids
1 to 75
-
Specifications
Our Abpromise guarantee covers the use of ab157284 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Binds Human and mouse TWEAK.
Inhibits TWEAK-mediated killing of Kym-1 target cells.This product was previously labelled as TWEAKR
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 50µl sterile water to a concentration of 1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- CD 266
- CD266
- CD266 antigen
see all -
Function
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins. -
Tissue specificity
Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas. -
Sequence similarities
Contains 1 TNFR-Cys repeat. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab157284 has not yet been referenced specifically in any publications.