Recombinant Mouse TWEAKR protein (Fc Chimera) (ab185863)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRL LWVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      33 kDa including tags
    • Amino acids
      28 to 79
    • Tags
      proprietary tag C-Terminus
    • Additional sequence information
      The recombinant fragment is fused with an FC tag.

Specifications

Our Abpromise guarantee covers the use of ab185863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab185863 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names
    • CD 266
    • CD266
    • CD266 antigen
    • FGF inducible 14
    • FGF-inducible 14
    • Fibroblast growth factor inducible immediate early response protein 14
    • Fibroblast growth factor-inducible immediate-early response protein 14
    • FN 14
    • FN14
    • TNFRSF 12A
    • TNFRSF12A
    • TNR12_HUMAN
    • Tumor necrosis factor receptor superfamily member 12A
    • TWEAK R
    • Tweak receptor
    • Tweak-receptor
    • TweakR
    see all
  • Function
    Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
  • Tissue specificity
    Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
  • Sequence similarities
    Contains 1 TNFR-Cys repeat.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab185863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up