Recombinant mouse Urokinase protein (ab92644)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • SpeciesMouse
    • SequenceKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGS PPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSKESSYNPGEMK FEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPR FTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGS

Specifications

Our Abpromise guarantee covers the use of ab92644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.1M Sodium chloride, 0.05M Sodium acetate, 1mM EDTA, pH 5.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • FunctionSpecifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificityExpressed in the prostate gland and prostate cancers.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant mouse Urokinase protein images

  • ab92644 (3 µg, nonreduced), staining Urokinase protein by SDS-PAGE.

References for Recombinant mouse Urokinase protein (ab92644)

ab92644 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"