Recombinant Mouse Urokinase protein (Biotin) (ab92642)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • SpeciesMouse
    • SequenceMKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIR RCSCPRKFQGEHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAV LQKPYNAHRPDAISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVH DCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQK
    • Amino acids1 to 433
  • ConjugationBiotin

Associated products

Specifications

Our Abpromise guarantee covers the use of ab92642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.1M Sodium chloride, 0.05M Sodium acetate, 1mM EDTA, pH 5.0

General Info

  • Alternative names
    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • FunctionSpecifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificityExpressed in the prostate gland and prostate cancers.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Mouse Urokinase protein (Biotin) (ab92642)

ab92642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"