Recombinant Mycobacterium tuberculosis Ag85B protein (ab73632)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SequenceMRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLD GLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKA GCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWER NDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
    • Additional sequence informationAg85B Recombinant His-Tag fusion protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab73632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Purity:Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • FormLyophilised
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    No additives

  • ReconstitutionReconstitute in sterile 18MOhm/cm water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names
    • 30 kDa extracellular protein
    • Antigen 85 complex B
    • Mycobacterium
    • Mycolyl transferase 85B
  • RelevanceAntigen 85B is the most abundant protein expressed by Mycobacterium tuberculosis (about one quarter). It is a myocolyc transferase in the myc pathway and catalyses - like Ag85A and Ag85C - the transfer of the fatty acid mycolate from one trehalose monomycolate to another, resulting in trehalose dimycolate and free trehalose and helping build the cell wall.

References for Recombinant Mycobacterium tuberculosis Ag85B protein (ab73632)

ab73632 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry.
Please find below the answers to your questions:

1.
I am happy to confirm that this protein (ab124604)is Antigen 85 sub unit A.

2.
a) ab73632 is the full length protein (aa 1 to 325)
b...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"