Recombinant Parvovirus B19 protein (ab187221)

Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Canine parvovirus
    • Sequence
      MSKKSGKWWESDDKFAKAVYQQFVEFYEKVTGTDLELIQILKDHYNISLD NPLENPSSLFDLVARIKNNLKNSPDLYSHHFQSHGQLSDHPHALSSSSSH AEPRGENAVLSSEDLHKPGQVSVQLPGTNYVGPGNELQAGPPQSAVDSAA RIHDFRYSQLAKLGINPYTHWTVADEELLKNIKNETGFQAQVVKDYFTLK GAAAPVAHFQGSLPEVPAYNASEKYPSMTSVNSAEASTGAGGGGSNSVKS MWSEGATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAK VCTISPIMGYSTPWRYLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTI SEIAVKDVTDKTGGGVQVTDSTTGRLCMLVDHEYKYPYVLGQGQDTLAPE LPIWVYFPPQYAYLTVGDVNTQGISGDSKKLASEESAFYVLEHSSFQLLG TGGTASMSYKFPPVPPENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPKF RSLTHEDHAIQPQNFMPGPLVNSVSTKEGDSSNTGAGKALTGLSTGTSQN TRISLRPGPVSQPYHHWDTDKYVTGINAISHGQTTYGNAEDKEYQQGVGR FPNEKEQLKQLQGLNMHTYFPNKGTQQYTDQIERPLMVGSVWNRRALHYE SQLWSKIPNLDDSFKTQFAALGGWGLHQPPPQIFLKILPQSGPIGGIKSM GITTLVQYAVGIMTVTMTFKLGPRKATGRWNPQPGVYPPHAAGHLPYVLY DPTATDAKQHHRHGYEKPEELWTAKSRVHPL
    • Molecular weight
      86 kDa
    • Amino acids
      1 to 781
    • Additional sequence information
      Capsid protein VP1
    Amino Acid Sequence 2
    • Accession
    • Species
      Canine parvovirus
    • Sequence
      MTSVNSAEASTGAGGGGSNSVKSMWSEGATFSANSVTCTFSRQFLIPYDP EHHYKVFSPAASSCHNASGKEAKVCTISPIMGYSTPWRYLDFNALNLFFS PLEFQHLIENYGSIAPDALTVTISEIAVKDVTDKTGGGVQVTDSTTGRLC MLVDHEYKYPYVLGQGQDTLAPELPIWVYFPPQYAYLTVGDVNTQGISGD SKKLASEESAFYVLEHSSFQLLGTGGTASMSYKFPPVPPENLEGCSQHFY EMYNPLYGSRLGVPDTLGGDPKFRSLTHEDHAIQPQNFMPGPLVNSVSTK EGDSSNTGAGKALTGLSTGTSQNTRISLRPGPVSQPYHHWDTDKYVTGIN AISHGQTTYGNAEDKEYQQGVGRFPNEKEQLKQLQGLNMHTYFPNKGTQQ YTDQIERPLMVGSVWNRRALHYESQLWSKIPNLDDSFKTQFAALGGWGLH QPPPQIFLKILPQSGPIGGIKSMGITTLVQYAVGIMTVTMTFKLGPRKAT GRWNPQPGVYPPHAAGHLPYVLYDPTATDAKQHHRHGYEKPEELWTAKSR VHPL
    • Molecular weight
      61 kDa
    • Amino acids
      228 to 781
    • Additional sequence information
      Capsid protein VP2

Specifications

Our Abpromise guarantee covers the use of ab187221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 80 % SDS-PAGE.
    The protein is purified by proprietary chromatographic technique.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.26% Sodium phosphate, 0.7% Sodium chloride, 20% Glycerol

General Info

  • Relevance
    Parvoviruses cause infections in a wide variety of birds and mammals. Parvovirus, commonly called parvo, is a genus of the Parvoviridae family linear, non-segmented single stranded DNA viruses with an average genome size of 5 kbp. Parvoviruses are some of the smallest viruses found in nature. Parvovirus B19 infection is common among children and adults and is often asymptomatic. Parvovirus B19 infection can result in serious and occasionally fatal hematologic diseases in susceptible patients, and is the cause of "fifth disease", a highly contagious infection of childhood. Parvovirus B19 can also infect the fetus causing severe anemia, congestive heart failure, and death in utero or at birth.

References

ab187221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up