Recombinant Picornain 3C protein (ab157275)

Overview

  • Product name
    Recombinant Picornain 3C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence
      GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVN GQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDAT LVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVL CATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
    • Molecular weight
      22 kDa
    • Amino acids
      1 to 182

Specifications

Our Abpromise guarantee covers the use of ab157275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    >1 Units/µg. One unit will cleave >95% of 100 µg control fusion protein in 50 mM Tris-HCl, 150 mM NaCl, pH 7.5 at 4°C for 16 h.
  • Applications

    Functional Studies

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes


    Substrate recognition and cleavage are likely to be dependent not only upon primary structural signals, but also upon the secondary and tertiary structures of the fusion protein as It has been demonstrated that the enzyme exhibits highest activity around neutral pH at temperature ranging from 22 to 37°C, even retaining robust activity at 4°C. Thus, cleavage can be performed at low temperature to enhance the stability of the target protein. The catalytic activity is insensitive to organic solvents (up to 10%); however, it can be strongly stimulated by high concentration of anions such as sulfate.

    The high specificity of ab157275 makes it an ideal tool for cleaving fusion proteins at definite cleavage sites. The enzyme recognizes the cleavage site: Leu-Glu-Val-Leu-Phe-Gln-Gly-Pro. >1 Units/µg. One unit will cleave >95% of 100 µg control fusion protein in 50 mM Tris-HCl, 150 mM NaCl, pH 7.5 at 4°C for 16 h.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituents: 0.61% Tris, 0.05% Tween, 0.03% EDTA, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • 3C
    • P3C
    • Protease 3C

Images

  • A 52 kDa Fc-Fusion protein (C) at 1/mg/ml is incubated with ab157275 at the ratio of (1) 1:50 (2) 1:100 (3) 1:200 (4) 1:400 (5) 1:800 (6) 1:1000 (w/w) in a buffer of 50 mM TRIS-HCl, 150mM NaCl, 1mM EDTA, 1mM dithiothreitol, pH 7.0 at 4 degC for 16 hours.

References

ab157275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up