Recombinant Protein G (ab49807)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Protein G
See all Protein G proteins and peptides -
Purity
> 95 % SDS-PAGE.
>98% by SDS-PAGE and HPLC analyses. The albumin binding domain as well as cell wall and cell membrane binding domains have been removed to ensure the maximum specific IgG binding capacity. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Streptococcus -
Sequence
LDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFL KSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKA LIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNG VDGE -
Predicted molecular weight
26 kDa including tags -
Amino acids
190 to 384 -
Tags
His tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab49807 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Affinity Purification
-
Form
Lyophilized -
Additional notes
This product is manufactured by BioVision, an Abcam company and was previously called 6510 Protein G. 6510-1 is the same size as the 1 mg size of ab49807.
Protein G can be used to detect, quantify and purify IgG antibodies and antibody/antigen complexes. The 6-His-tag on N-terminus can be used for affinity purification or protein G detection using anti-His-tag antibodies.
This protein contains only IgG binding domains.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
pH: 7.40
Constituents: 10.269% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate
General Info
-
Alternative names
- IgG binding protein G
- IgG-binding protein G
- Immunoglobulin G binding protein G [Precursor]
see all -
Relevance
Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab') fragments of IgG. Due to it's affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology. -
Cellular localization
Cell Wall and Secreted
Images
-
Different amounts of Recombinant Protein G loaded under reducing conditions and stained with Coomassie Blue. The protein has a predicted molecular weight (MW) of ∼ 26.1 kDa. However it runs larger on a SDS-PAGE gel. SDS-PAGE (12%) of Recombinant Protein G:
Lane 1: MW Marker
Lane 2 : Protein G ( 2.2 µg)
Lane 3 : Protein G ( 4.4 µg)
Lane 4 : Protein G ( 8.8 µg)
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab49807 has been referenced in 5 publications.
- Yasunaga AB & Li ITS Quantification of fast molecular adhesion by fluorescence footprinting. Sci Adv 7:N/A (2021). PubMed: 34407937
- Korodi M et al. Reusable on-plate immunoprecipitation method with covalently immobilized antibodies on a protein G covered microtiter plate. J Immunol Methods 483:112812 (2020). PubMed: 32569597
- Park S et al. Force-dependent trans-endocytosis by breast cancer cells depletes costimulatory receptor CD80 and attenuates T cell activation. Biosens Bioelectron 165:112389 (2020). PubMed: 32729511
- Li IT et al. Mapping cell surface adhesion by rotation tracking and adhesion footprinting. Sci Rep 7:44502 (2017). PubMed: 28290531
- Wang X et al. Constructing modular and universal single molecule tension sensor using protein G to study mechano-sensitive receptors. Sci Rep 6:21584 (2016). PubMed: 26875524