Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      HIV-1
    • Sequence
      MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKV FK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKT L KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
    • Molecular weight
      22 kDa
    • Amino acids
      190 to 384
    • Additional sequence information
      Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present.

Specifications

Our Abpromise guarantee covers the use of ab73758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    The isoelectric point is pH 4.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10mM PBS, pH 7.4

  • Reconstitution
    Reconstitution with deionized water or PBS

General Info

  • Alternative names
    • IgG binding protein G
    • IgG-binding protein G
    • Immunoglobulin G binding protein G [Precursor]
    • spg
    • spg immunoglobulin G-binding protein
    • SPG2_STRSG
    see all
  • Relevance
    Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab') fragments of IgG. Due to it's affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology.
  • Cellular localization
    Cell Wall and Secreted

References

ab73758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As



Ma collègue est actuellement en contact avec un laboratoire américain pour la protéine G entière sans tag.

Elle m'a dit qu'elle espérait un retour dans la semaine mais n'oublions pas que jeudi et ve...

Read More

J'aimerais vous informer que mes collègues responsables de l'intégration des produits travaillent toujours à la recherche d'un collaborateur qui pourrait nous fournir :
- une protéine G (full length sans tag) en compl&ea...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up