Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected insect cells
  • Amino Acid Sequence
    • AccessionP41246
    • SpeciesRabbit
    • SequenceAPRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRL PLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHH NITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQ FGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVP TYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFG FCPSERLYTQDGNADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTAS YDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSSCTSEGRRDG RLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLM YPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACP TWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVN VFDAIAEIGNKLHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDS AFEEPLTKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGPEVPHVTGALPR AGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNTHDVFQYRE KAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPEDENLYFQGLEEQK LISEEDLNSAVDHHHHHH.
    • Molecular weight80 kDa including tags
    • Amino acids20 to 707
    • Additional sequence informationFused to a 30 aa C-terminal Myc-His tag, having a total MW of 79.94kDa.

Specifications

Our Abpromise guarantee covers the use of ab125814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Additional notes

    Purified MMP9 protein appears at 95kDa on SDS-PAGE gel due to protein modification.

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under Desiccating conditions.

    pH: 7.50
    Constituents: 0.61% Tris, 10% Glycerol, 1.75% Sodium chloride

General Info

  • Alternative names
    • 82 kDa matrix metalloproteinase-9
    • 92 kDa gelatinase
    • 92 kDa type IV collagenase
    • CLG 4B
    • CLG4B
    • Collagenase Type 4 beta
    • Collagenase type IV 92 KD
    • EC 3.4.24.35
    • Gelatinase 92 KD
    • Gelatinase B
    • Gelatinase beta
    • GelatinaseB
    • GELB
    • Macrophage gelatinase
    • MANDP2
    • Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
    • Matrix Metalloproteinase 9
    • MMP 9
    • MMP-9
    • MMP9
    • MMP9_HUMAN
    • Type V collagenase
    see all
  • FunctionMay play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-
    -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
  • Tissue specificityProduced by normal alveolar macrophages and granulocytes.
  • Involvement in diseaseIntervertebral disc disease
    Metaphyseal anadysplasia 2
  • Sequence similaritiesBelongs to the peptidase M10A family.
    Contains 3 fibronectin type-II domains.
    Contains 4 hemopexin repeats.
  • DomainThe conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.
    N- and O-glycosylated.
  • Cellular localizationSecreted, extracellular space, extracellular matrix.
  • Information by UniProt

Recombinant Rabbit MMP9 protein images

  • SDS-PAGE gel showing ~95 kDa

References for Recombinant Rabbit MMP9 protein (ab125814)

ab125814 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"