Recombinant rabbit Urokinase protein (ab92603)

Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Species
      Rabbit
    • Sequence
      MSHELHGVSDASNCGCLNGGTCVTYKYFSNIWRCNCPKKFQGEHCEIDTL KTCYHGDGHSYRGKANTDIMDRPCLAWNSANVLTKTYHAHRPDALQLGLG KHNYCRNPDHQRRPWCYVQVGLKQLIQECKVHDCSSGKKPALPPGKLEFQ CGQKALRPRFKIIGGEFTIIENQPWFAAIYRRHRGGSVTYVCGGSLISPC
    • Amino acids
      21 to 433

Specifications

Our Abpromise guarantee covers the use of ab92603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity: 200,000 IU/mg (Relative to WHO International Standard for Human High Molecular Weight Urokinase, NIBSC 87/594)
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.1M Sodium chloride, 0.05M Sodium acetate, 1mM EDTA, pH 5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ATF
    • ATF uPA
    • BDPLT5
    • Plasminogen activator
    • Plasminogen activator urinary
    • Plasminogen activator urokinase
    • PLAU
    • QPD
    • u PA
    • U plasminogen activator
    • u-PA
    • U-plasminogen activator
    • uPA
    • URK
    • UROK_HUMAN
    • Urokinase plasminogen activator
    • Urokinase type plasminogen activator
    • Urokinase type plasminogen activator precursor
    • Urokinase-type plasminogen activator chain B
    see all
  • Function
    Specifically cleave the zymogen plasminogen to form the active enzyme plasmin.
  • Tissue specificity
    Expressed in the prostate gland and prostate cancers.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 EGF-like domain.
    Contains 1 kringle domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Phosphorylation of Ser-158 and Ser-323 abolishes proadhesive ability but does not interfere with receptor binding.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant rabbit Urokinase protein images

  • 10% SDS-PAGE showing ab92603
    Lane 1 Urokinase Non-reduced (3µg)
    Lane 2 Urokinase Reduced (3µg)

References for Recombinant rabbit Urokinase protein (ab92603)

ab92603 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up