Recombinant Rat B2M + FCGRT protein (ab191649)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence 1
    • Accession
    • Species
      Rat
    • Sequence
      IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIE MSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
    • Molecular weight
      13 kDa
    • Amino acids
      21 to 119
    • Additional sequence information
      This product is the mature full length B2M protein from aa 21 to 119. The signal peptide is not included. B2M is fused with Strep II tag at the C-terminus (NP_036644).
    Amino Acid Sequence 2
    • Accession
    • Species
      Rat
    • Sequence
      AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGA WIWENQVSWYWEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCEL APDNSSLPTAVFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMKQPEAA RKESEFLLTSCPERLLGHLERGRQNLEWKEPPSMRLKARPGNSGSSVLTC AAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEH HYQCQVEHEGLAQPLTVDLDSPARSS
    • Molecular weight
      32 kDa
    • Amino acids
      23 to 298
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain of FCGRT (NM_033351.1).

Specifications

Our Abpromise guarantee covers the use of ab191649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at +4°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • beta chain of MHC class I molecules
    • beta-2-microglobin
    • Beta-2-microglobulin
    • c fragment of IgG, receptor, transporter, alpha
    • Fc Fragment of IgG, receptor transporter, alpha
    • FcRn
    • FcRn alpha chain
    • IgG Fc fragment receptor transporter alpha chain
    • IgG receptor FcRn large subunit p51
    • immunoglobulin receptor, intestinal, heavy chain
    • major histocompatibility complex class I-like Fc receptor
    • Neonatal Fc receptor
    • neonatal Fc-receptor for Ig
    see all
  • Relevance
    FCGRT + B2M heterodimer protein (FcRn complex) consist of two subunits: p51 (equivalent to FCGRT), and p14 (equivalent to beta-2-microglobulin), and forms an MHC class I-like heterodimer. Fc fragment of IgG, receptor, transporter, alpha (FCGRT) binds to the Fc region of monomeric immunoglobulins gamma and mediates the uptake of IgG from milk. FCGRT has a possible role in transfer of immunoglobulin G from mother to fetus. Beta-2-microglobulin (B2M) is a component of the class I major histocompatibility complex (MHC) and involved in the presentation of peptide antigens to the immune system.
  • Cellular localization
    FCGRT: Cell membrane; Single-pass type I membrane protein B2M: Secreted

Images

  • SDS-PAGE analysis of DTT-reduced ab191649 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 45-50 kDa (FCGRT) and 14.5 kDa (B2M) respectively due to different glycosylation.

References

ab191649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up