Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
    • Molecular weight
      23 kDa
    • Amino acids
      2 to 200

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab123755 is purified by proprietary chromatographic techniques. Purity by SDS-PAGE and gel filtration is greater than 99%.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 0.025% Sodium carbonate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in sterile ddH2O or 0.4 % NaHCO3 adjusted to pH 8-9 to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein. Reconstituted CNTF should be stored at 4°C for 2-7 days and as working aliquots at -20°C for future use. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Ciliary neurotrophic factor
    • CNTF
    • CNTF_HUMAN
    • HCNTF
  • Function
    CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  • Tissue specificity
    Nervous system.
  • Sequence similarities
    Belongs to the CNTF family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant rat CNTF protein (ab123755)

ab123755 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up