Recombinant rat CX3CL1 protein (ab201406)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant rat CX3CL1 protein
See all CX3CL1 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration of 5.0-10 ng/ml.
-
Purity
> 95 % SDS-PAGE.
>95% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFC ADPKEKWVQDAMKHLDHQTAALTRNG -
Predicted molecular weight
9 kDa -
Amino acids
25 to 100 -
Additional sequence information
Single non-glycosylated polypeptide chain.
-
Specifications
Our Abpromise guarantee covers the use of ab201406 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilised from a 0.2µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- A 152E5.2
- AB030188
- ABCD 3
see all -
Function
The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. -
Tissue specificity
Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. -
Sequence similarities
Belongs to the intercrine delta family. -
Post-translational
modificationsA soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
O-glycosylated with core 1 or possibly core 8 glycans. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab201406 has not yet been referenced specifically in any publications.