Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN
    • Molecular weight
      11 kDa
    • Amino acids
      28 to 100

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product was determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • C-X-C motif chemokine 2
    • Chemokine (C X C motif) ligand 2
    • Chemokine, CXC motif, ligand 2
    • CINC 2a
    • CINC2a
    • CINC3
    • CXC chemokine
    • CXCL 2
    • Cxcl2
    • CXCL2_HUMAN
    • Cytokine-induced neutrophil chemoattractant 3
    • GRO 2
    • GRO b
    • GRO protein, beta
    • Gro-beta
    • GRO-beta(5-73)
    • GRO-beta-T
    • GRO2
    • GRO2 oncogene
    • GROb
    • GRObeta
    • Growth regulated protein beta
    • Growth-regulated protein beta
    • GROX
    • Hematopoietic synergistic factor
    • HSF
    • Macrophage inflammatory protein 2
    • Macrophage inflammatory protein 2 alpha
    • Macrophage inflammatory protein 2-alpha
    • Melanoma growth stimulatory activity beta
    • MGSA b
    • MGSA beta
    • MIP 2
    • MIP 2a
    • MIP2
    • MIP2 alpha
    • MIP2-alpha
    • MIP2A
    • MIP2alpha
    • SB-251353
    • Scyb
    • SCYB 2
    • SCYB2
    • Small inducible cytokine subfamily B, member 2
    see all
  • Function
    Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications
    The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant rat CXCL2 protein (ab9778)

ab9778 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab9778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up