Recombinant rat FGF2 protein (Animal Free) (ab179499)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    • Molecular weight
      16 kDa
    • Amino acids
      9 to 154

Specifications

Our Abpromise guarantee covers the use of ab179499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by the dose-dependent proliferation of mouse 3T3 cells and is typically less than 1 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    <=1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Basic fibroblast growth factor
    • Basic fibroblast growth factor bFGF
    • BFGF
    • FGF 2
    • FGF B
    • FGF-2
    • Fgf2
    • FGF2 basic
    • FGF2_HUMAN
    • FGFB
    • Fibroblast growth factor 2
    • Fibroblast growth factor 2 (basic)
    • Fibroblast growth factor, basic
    • HBGF 2
    • HBGF-2
    • HBGF2
    • HBGH 2
    • HBGH2
    • Heparin binding growth factor 2 precursor
    • Heparin-binding growth factor 2
    • Prostatropin
    see all
  • Function
    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
  • Tissue specificity
    Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications
    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localization
    Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
  • Information by UniProt

Images

  • Dose-dependent proliferation of mouse NIH 3T3 cells using ab179499. Cells were incubated for 7 hours and measured at 490 nm. Assays were carried out in triplicate.

References

ab179499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up