Recombinant rat IL17A + IL17F protein (ab109681)

Overview

  • Product nameRecombinant rat IL17A + IL17F protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence 1
    • AccessionQ61453
    • SpeciesRat
    • SequenceMAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRST SPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
    • Molecular weight15 kDa
    • Amino acids18 to 150
    Amino Acid Sequence 2
    • AccessionQ5BJ95
    • SpeciesRat
    • SequenceMAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRST SPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
    • Molecular weight15 kDa
    • Amino acids29 to 161

Specifications

Our Abpromise guarantee covers the use of ab109681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe ED50 of ab109681, as determined by its ability to induce IL-6 production in NIH-3T3 cells, is 7.28ng/mL.
  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 98 % SDS-PAGE.
    Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    Preservative: None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions. The formulation is from 0.02% TFA before product is lyophilized

General Info

  • Alternative names
    • Ctla 8
    • CTLA8
    • Cytokine ML1
    • Cytotoxic T lymphocyte associated antigen 8
    • CYTOTOXIC T LYMPHOCYTE ASSOCIATED SERINE ESTERASE 8
    • IL 17F
    • IL17
    • IL24
    • Interleukin 17A
    • Interleukin 17F
    • Interleukin 24
    • ML 1
    • ML1
    • mutant IL 17F
    see all
  • RelevanceIL17F stimulates the production of other cytokines such as IL-6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. IL17A induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Cellular localizationSecreted

Recombinant rat IL17A + IL17F protein images

  • ab109681 used in Western Blot. Figure: 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Rat IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.

References for Recombinant rat IL17A + IL17F protein (ab109681)

ab109681 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"