Recombinant rat IL17A + IL17F protein (ab109681)

Overview

  • Product name
    Recombinant rat IL17A + IL17F protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence 1
    • Accession
    • Species
      Rat
    • Sequence
      MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRST SPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
    • Molecular weight
      15 kDa
    • Amino acids
      18 to 150
    Amino Acid Sequence 2
    • Accession
    • Species
      Rat
    • Sequence
      MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRST SPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILV LKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
    • Molecular weight
      15 kDa
    • Amino acids
      29 to 161

Specifications

Our Abpromise guarantee covers the use of ab109681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The ED50 of ab109681, as determined by its ability to induce IL-6 production in NIH-3T3 cells, is 7.28ng/mL.
  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    Preservative: None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions. The formulation is from 0.02% TFA before product is lyophilized

General Info

  • Alternative names
    • Ctla 8
    • CTLA8
    • Cytokine ML1
    • Cytotoxic T lymphocyte associated antigen 8
    • CYTOTOXIC T LYMPHOCYTE ASSOCIATED SERINE ESTERASE 8
    • IL 17F
    • IL17
    • IL24
    • Interleukin 17A
    • Interleukin 17F
    • Interleukin 24
    • ML 1
    • ML1
    • mutant IL 17F
    see all
  • Relevance
    IL17F stimulates the production of other cytokines such as IL-6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. IL17A induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Cellular localization
    Secreted

Images

  • ab109681 used in Western Blot. Figure: 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Rat IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.

References

ab109681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up