Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNST LRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNK DLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
    • Molecular weight
      17 kDa
    • Amino acids
      27 to 169

Specifications

Our Abpromise guarantee covers the use of ab9873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The ED50, determined by the dose-dependent stimulation of the proliferation of thymidine uptake by murine MC-9 cells, is < 10.0 ng/ml, corresponding to a specific activity of > 1 x 105 units/mg.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • BPA
    • Csfmu
    • HCGF
    • Hematopoietic growth factor
    • Il 3
    • IL-3
    • IL3
    • IL3_HUMAN
    • IL3B
    • Interleukin 3
    • Interleukin 3 beta
    • Interleukin-3
    • Mast cell growth factor
    • Mast-cell growth factor
    • MCGF
    • MGC79398
    • MGC79399
    • MULTI-CSF
    • Multilineage colony stimulating factor
    • Multipotential colony-stimulating factor
    • OTTMUSP00000005831
    • P cell stimulating factor
    • P-cell-stimulating factor
    • PSF
    • RP23-309E16.5
    see all
  • Function
    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
    This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Tissue specificity
    Activated T-cells, mast cells, natural killer cells.
  • Sequence similarities
    Belongs to the IL-3 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant rat IL3 beta protein (ab9873)

ab9873 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab9873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up